SKU: 77673789900

Human IL-8 , His tag

Sale price$166.50 Regular price$185.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-8 , His tagProduct Specification Species Human Synonyms C X C motif chemokine 8, Chemokine (C X C motif) ligand 8, Emoctakin, Granulocyte chemotactic protein 1 (GCP 1), Monocyte derived neutrophil chemotactic factor (MDNCF), CXCL8 Accession P10145 Amino Acid Sequence Protein sequence(P10145, Ser28 Ser99, with C 10*His) SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENSGGGGSHHHHHHHHHH Expression System CHO Molecular Weight Theoretical: 10.

Product Specification


Species Human
Synonyms C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Emoctakin, Granulocyte chemotactic protein 1 (GCP-1), Monocyte-derived neutrophil chemotactic factor (MDNCF), CXCL8
Accession P10145
Amino Acid Sequence

Protein sequence(P10145, Ser28-Ser99, with C-10*His) SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENSGGGGSHHHHHHHHHH

Expression System CHO
Molecular Weight

Theoretical:10.1kDa Actual:10kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Interleukin 8 (IL-8 or chemokine (C-X-C motif) ligand 8, CXCL8) is a chemokine produced by macrophages and other cell types such as epithelial cells, airway smooth muscle cells and endothelial cells. Endothelial cells store IL-8 in their storage vesicles, the Weibel-Palade bodies. IL-8 is initially produced as a precursor peptide of 99 amino acids which then undergoes cleavage to create several active IL-8 isoforms. In culture, a 72 amino acid peptide is the major form secreted by macrophages. Interleukin-8 is a key mediator associated with inflammation where it plays a key role in neutrophil recruitment and neutrophil degranulation. IL-8 has also been implied to have a role in colorectal cancer by acting as an autocrine growth factor for colon carcinoma cell lines or the promotion of division and possible migration by cleaving metalloproteinase molecules. It has also been shown that IL-8 plays an important role in chemoresistance of malignant pleural mesothelioma by inducing expression of transmembrane transporters.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 77673789900

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 1438 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
susan w
Birmingham, US
★★★★★ 5
Light and Feels like whipped butter - Tinted
Size: 1.7 Ounce (Pack of 1)
Love the tinted type of this. Soft and creamy to put on my face and feels lighweight. Color is not overwhelming.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2026
E
Verified Purchase
Evgeniya Krasnikova
Pawtucket, US
★★★★★ 5
Excellent sunscreen, my favorite
Size: 1.7 Ounce (Pack of 1), Size: 1.7 Ounce (Pack of 1)
In search for a perfect tinted sunscreen I have tried just about every brand of tinted mineral sunscreen that’s available here on Amazon, so you might recognize me from other reviews. I have a sensitive skin and can’t tolerate chemical sunscreen. I also have red and bumpy skin on my cheeks due to rosacea, so I need a tint to cover redness. I’m really glad I finally decided to give Sunbum tinted sunscreen a try because it quickly became one of my favorites. My other favorite is MD Solar Science BB cream in shade Light. These two are quite similar, both are very silicone like, due to a great amount of dimethicone. They feel like primers and because of that are very sticky and hard to wash off your fingers. But both look very natural and skin like. MD Solar Science (light shade) is slightly darker while Sunbum is pretty pale but not in an unhealthy way. My skin is a bit darker than Sunbum shade right now. Yet it covers my rosacea and evens out my skin tone just enough. It’s not drying but also not shiny, and because of that it doesn’t magnify wrinkles, which is a big plus: I’m tired of tinted sunscreens highlighting the wrinkles I have that are not even noticeable without them. Sunbum is slightly lighter and provides a bit less coverage than MD Solar. It also doesn’t have much zinc, which was a point of criticism from popular bloggers. Because of that it might not be perfect for everyday wear. But if you want to have the most natural “no make up” look and you’re light skinned, this is a great choice on the days when you’re not expecting to be under too much sun. I use retinol on my forehead at night and I didn’t get sunburnt when using this sunscreen. So the only concern here would be the gradually accumulated damage from the long UV-A rays. Another thing I like is that unlike MD Solar, Sunbum doesn’t contain vitamin C and therefore doesn’t irritate my sensitive skin. It’s also less expensive. I will keep repurchasing. Note: in the unfiltered photo attached here, you can see the sunscreen after a 5 hour wear, that included eating, touching my face etc, so it’s a bit worn off and the redness on my cheeks is more visible. Even when freshly applied it didn’t cover redness completely because of being light coverage sunscreen.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 20, 2023
D
Verified Purchase
DeeAyGee
Whiting, US
★★★★★ 3
Decent but not the best
Size: 1.7 Ounce (Pack of 1)
I like that this sunscreen is matte and tinted, but that’s about it. I have pretty oily skin and the mattifying effect only lasts for about 6-7 hours. Unfortunately this product doesn’t absorb very well either. It tends to accumulate in any wrinkles and also tends to sit on top of any sort of facial hair or areas of dry skin. A much better product, that absorbs very well and controls oil literally all day long, is Trader Joe’s mattifying facial sunscreen in the sea foam green tube. It isn’t tinted like Sun Bum but it beats it in every other category, especially in price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2026
R
Verified Purchase
Rachel
Louisville, US
★★★★★ 5
Holy grail face SPF - mineral, tinted and matte
Size: 1.7 Ounce (Pack of 1)
Title says it all. This is my holy grail face SPF. It’s mineral and non-toxic. It’s lightly tinted so it looks beautiful on your skin alone and helps even out your skin. It’s also matte so it wears well under makeup. It’s moisturizing and applies and blends smoothly onto the skin. Amazing product. I have it on subscribe and save.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 10, 2025
Y
Verified Purchase
Yilian
Phoenix, US
★★★★★ 5
Lightweight, non-greasy protection you can trust
Size: 1.7 Fl Oz (Pack of 1), Size: 1.7 Fl Oz (Pack of 1)
This Neutrogena Ultra Sheer sunscreen is one of the best I’ve tried, especially if you don’t like heavy or greasy sunscreens. It has a very lightweight texture that absorbs quickly into the skin and leaves a dry-touch finish, so it doesn’t feel sticky or oily at all. What I really like is that it provides strong broad-spectrum SPF protection while still feeling comfortable for everyday use. It works great under makeup and doesn’t leave a white cast, which is a big plus. I’ve used it on my face and body, and it hasn’t caused any breakouts or irritation. It’s also water-resistant, so it’s perfect for hot days or outdoor activities. Overall, this is a reliable sunscreen that gives you high protection without that heavy sunscreen feeling. Definitely a must-have for daily skincare.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 20, 2026

recommand products