SKU: 69414171573

Human C1q , His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 16 - Jul 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human C1q , His tagProduct Specification Species Human Synonyms Complement C1q subcomponent subunit A Accession P02745 Amino Acid Sequence Protein sequence(P02745, Glu23 Arg150, with C 10*His) EDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 14. 7kDa Actual: 20 25kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag His Tag

Product Specification


Species Human
Synonyms Complement C1q subcomponent subunit A
Accession P02745
Amino Acid Sequence Protein sequence(P02745, Glu23-Arg150, with C-10*His) EDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRGGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight Theoretical:14.7kDa Actual:20-25kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

The complement component 1q (or simply C1q) is a protein complex involved in the complement system, which is part of the innate immune system. Antibodies of the adaptive immune system can bind antigen, forming an antigen-antibody complex. When C1q binds antigen-antibody complexes, the C1 complex becomes activated. Activation of the C1 complex initiates the classical complement pathway of the complement system. By virtue of its ability to bind to IgG and IgM containing immune complexes and activating the classical pathway, C1q acts as prototypical link between innate and adaptive immune wings of the immune system. The notion of C1q involvement in the pathogenesis of cancer is still evolving. C1q appears to have a dual role in cancer: tumor promoting as well as tumor-protective, depending on the context of the disease.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 69414171573

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Celso S. Delgado
Charlottesville, US
★★★★★ 4
Works great for 6 months, then gets dull
Color: Gold &black
Worked very well initially. Easy to charge, no nicking or pulling. But after about 6-7 months it got noticeably less sharp, with only moderate use (once every couple of weeks). Now at about a year out from purchase it’s much harder to get a close trim. Currently debating whether to simply buy a new one of the same version or switch up brands. Bottom line if you want something cheap and dependable for 6 months, go for this. If you want something that lasts longer, maybe opt for a higher price point.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 2, 2026
S
Verified Purchase
Shailyn
Carnegie, US
★★★★★ 5
I love this product 💖💕
Color: White
Title: Smooth, Easy to Use & Perfect for Sensitive Skin ⭐⭐⭐⭐⭐ I’m really impressed with this 3-in-1 bikini trimmer from ANYLIV! It’s lightweight, easy to hold, and works gently without pulling or irritating the skin. The different attachments make it super convenient for multiple areas, and the results are smooth and clean every time. I also love that it’s quiet, rechargeable, and compact enough for travel. Great quality for the price and very beginner-friendly. Definitely a must-have for personal grooming!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
Y
Verified Purchase
YAS A.
Draper, US
★★★★★ 5
Versatile & cute. Perfect for selfcare✨
Color: White, Color: White
I love this 3-in-1 shaver! It comes with everything you need for face and body upkeep, including a lady shaver, an eyebrow trimmer, and a body/beard shaver attachment. It’s waterproof, charges quickly via USB, and even has a sleek LED display. The packaging is super cute too! Definitely a great all-in-one tool for daily routines. 10/10 recommend! It’s efficient, gentle on the skin, and feels like a luxury upgrade to a standard razor!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
E
Verified Purchase
Emily Fitzgerald
Port Orchard, US
★★★★★ 5
Smooth, painless, and perfect for travel!
Color: White
I’ve tried a few different bikini trimmers over the years, and this one is honestly one of my favorites. It’s super easy to use, doesn’t pull or irritate my skin, and leaves everything feeling smooth without razor burn. I love that it comes with multiple attachments so I can use it for my bikini area, underarms, and even quick touch-ups on my face. The display is a nice bonus because I can actually see the battery level, and the USB charging makes it really convenient for travel. It’s lightweight, waterproof, and easy to clean too. Overall, such a great tool for the price!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026
S
Verified Purchase
SuzeeeQ
Carnegie, US
★★★★★ 4
Beware of Bikini Trimming
Color: White
This shaver is very sharp, On dry skin it shaved my legs so close that it felt as if I had silky smooth legs as if I had used a high quality cream, almost slippery. My underarms however were a little sensitive to deodorant after. I must have misunderstood the description as I thought there was a brow trimmer accessory included, not, just the nose hair trimmer which is ok. Don't really need that, needed the brow trimmer. All this review put together makes me think this was made for men, or trans.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 11, 2026

recommand products