SKU: 78025368036

Mouse NK1.1/CD161, His tag

Sale price$166.50 Regular price$185.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse NK1.1/CD161, His tagProduct Specification Species Mouse Synonyms Killer cell lectin like receptor subfamily B member 1C, CD161 antigen like family member C, Lymphocyte antigen 55c (Ly 55c), NKR P1. 9, NKR P1C, Natural killer cell surface protein P1 40 (NKR P1 40), Klrb1c Accession P27814 Amino Acid Sequence Protein sequence(P27814, Gln67 Ser223, with C 10*His)

Product Specification


Species Mouse
Synonyms Killer cell lectin-like receptor subfamily B member 1C, CD161 antigen-like family member C, Lymphocyte antigen 55c (Ly-55c), NKR-P1.9, NKR-P1C, Natural killer cell surface protein P1-40 (NKR-P1 40), Klrb1c
Accession P27814
Amino Acid Sequence

Protein sequence(P27814, Gln67-Ser223, with C-10*His) QKPSREKCCVFIQENLNKTTDCSVNLECPQDWLLHRDKCFHVSQVSNTWEEGQADCGRKGATLLLIQDQEELRFLLDSIKEKYNSFWIGLRFTLPDMNWKWINGTTFNSDVLKITGVTENGSCASILGDKVTPESCASDNRWICQKELNHETPSNDSGGGGSHHHHHHHHHH

Expression System CHO
Molecular Weight Theoretical:19.6kDa Actual:28kDa
Purity

>90% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD161 is one of the earliest markers expressed during NK cell maturation from CD34+ hematopoietic stem cell precursors. Expression of CD161 correlates with the cytotoxic function of CD16+ NK cells, and ligation of CD161 with its ligand LLT1 inhibits NK cell cytotoxicity and cytokine secretion. CD161 is expressed early in NK cell development, where it may facilitate cross-talk of NK cell precursors with cells within the bone marrow, and is involved in CXCL8 release. Within the periphery, cross-linking of CD161 leads to an increase in IFNγ expression and inhibition of NK cell cytotoxicity. There have been various reports of modulated expression of CD161 on NK cells during viral infections. For instance, reduced CD161 expression in acute hepatitis C virus (HCV) infection predicted viral clearance, and correlated with increased liver inflammation in chronic HCV infection. Patients with chronic human immunodeficiency virus (HIV) infection have depleted CD161+ NK cells compared to healthy donors.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 78025368036

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 1448 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Divine Rose Temple
Houston, US
★★★★★ 5
Cool Caddy
Color: Hanging-silver
This is a cool little caddy, but it must have enough space around it, otherwise, it could easily get knocked off it's mounting bracket. The caddy body itself sits smoothly into two small arms that hold it up; however, it's not a snap on tight design, so if you knock it, it will easily dismantle into the sink. We have two small sinks, it works good for it, but must have it's own little space where there isn't too much movement around it. Jus saying, and the quality is good.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2026
I
Verified Purchase
Iiquid
Omaha, US
★★★★★ 5
Well-Designed and Durable Sink Organizer for Daily Use
Color: Suction cup-Black
The sink caddy arrived on time and was securely packaged. The stainless steel construction feels solid and resistant to rust. It fits neatly inside the sink without taking up too much space. The organizer holds sponges, brushes, and dishcloths in an orderly way. Water drains easily, helping items dry faster and stay cleaner. Installation was simple and did not require any tools. The design blends well with most modern kitchen sinks. It helps reduce clutter around the sink area during daily use. Fit may vary depending on sink size and faucet placement. Overall, this is a practical and well-made kitchen sink accessory that works as expected.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 8, 2026
O
Verified Purchase
OG I.T.
Port Orchard, US
★★★★★ 4
Good little rack for sink brushes and sponges.
Color: Suction cup-Black
A lightweight little rack, works just fine. It occasionally slides up out of the suction cups that connect it, hence the 4 star rating.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 23, 2026
R
Verified Purchase
Roberta M. Martin
Draper, US
★★★★★ 5
Looks good. Neat and out of the way.
Color: Suction cup-Black, Color: Suction cup-Black
The suction cups didn’t stick to my sink, but the plastic strip adhered well. My husband didn’t even notice it on our sink for half a day. That was the look I was going for!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
L
Verified Purchase
Lea McGuire
Bozeman, US
★★★★★ 3
Better than the plastic ones
Color: Suction Cup-white
Stays in place on sink wall. Unfortunately it’s not coated very well and is already showing rust
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026

recommand products